Search Site
Advanced Search

Sermorelin

Catalog No. A6020
Size Price Stock Qty
2mg
$12.00
In stock
Bulk Orders?
Research Use Only.
Your First Order 15% Coupon: new15 

Sermorelin

Quality Control & MSDS

View current batch:

Properties

Cas No. 86168-78-7
Chemical Name Sermorelin
Formula C149H246N44O42S
One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2
Three Letter Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Molecular Weight (MW) 3357.88
Solubility aqueous soluble
Storage Lyophilized SERMORELIN although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.

Overview

Sermorelin is a 29 amino acid peptide of human growth hormone-releasing hormone (GHRH), with full biological activity of GHRH.

GHRH is a polypeptide with 44 amino acids that stimulates the secretion of growth hormone (GH) from the adenohypophysis. GH is a larger molecule containing 191 amino acids and synthesized in the perventricular arcuate neurons and transported to terminals of neurons.

Sermorelin can stimulate the secretion of GHRH from the anterior pituitary, and it is used as a test for GH secretion [1]. Sermorelin is usally used extensively in anti-aging therapy along with testosterone in men. Sermorelin Acetate affects a more primary source of failure in the GH neuroendocrine axis, has more physiological activity. It has been reported that sermorelin therapy increased the volume of hormone secreted by the stimulated pituitary gland, which is later converted by the liver into IGF-1. The increased amount of IGF-1 in the blood stream leads to metabolism increasing and growth of new cells [1]. Sermorelin therapy increased IGF-1 production, improved sex drive, higher energy levels, reduction of abdominal fat, and increased endurance etc. The combinant treatment of Sermorelin and GHRP-6 may cause functional and effective GH secretion [2].

A6020_1

Figure 1. the amino acid sequences of sermorelin.

References:

1. Prakash A, Goa KL. Sermorelin: a review of its use in the diagnosis and treatment of children with idiopathic growth hormone deficiency. BioDrugs. 1999 Aug;12(2):139-57.

2. Micic D, Popovic V, Kendereski A et al. Growth hormone secretion after the administration of GHRP-6 or GHRH combined with GHRP-6 does not decline in late adulthood. Clin Endocrinol (Oxf). 1995 Feb;42(2):191-4.