Search Site
Advanced Search

Sermorelin

Catalog No. A6020
Size Price Stock Qty
2mg
$12.00
In stock
Bulk Orders?
Free Delivery on all orders over $200.
Your First Order 15% Coupon: new15 

Sermorelin

Quality Control & MSDS

View current batch:

Properties

Cas No. 86168-78-7
Chemical Name Sermorelin
Formula C149H246N44O42S
One Letter Sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2
Three Letter Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Molecular Weight (MW) 3357.88
Solubility aqueous soluble
Storage Lyophilized SERMORELIN although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution FST should be stored at 4°C between 2-7 days and for future use below -18°C.
SDF N/A

Overview

Sermorelin, sometimes called GRF 1-29 NH2 with sequence YADAIFTNSYRKVLGQLSARKLLQDIMNR-NH2